PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold03577-abinit-gene-0.7-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NF-YB
Protein Properties Length: 231aa    MW: 25488.7 Da    PI: 6.5014
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold03577-abinit-gene-0.7-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1711.4e-5362157297
                                                 NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrek 58 
                                                           reqd+++Pianv+rim+++lP++akis+daket+qecvse+isf+t+ea+++cqre+
  augustus_masked-scaffold03577-abinit-gene-0.7-mRNA-1  62 REQDQYMPIANVIRIMRRILPSHAKISDDAKETIQECVSEYISFITGEANERCQREQ 118
                                                           89******************************************************* PP

                                                 NF-YB  59 rktingddllwalatlGfedyveplkvylkkyrelegek 97 
                                                           rkt++++d+lwa+++lGf+dyvepl+vyl++yre+e+e+
  augustus_masked-scaffold03577-abinit-gene-0.7-mRNA-1 119 RKTVTAEDVLWAMGKLGFDDYVEPLTVYLNRYREAENER 157
                                                           ************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.5E-4958159IPR009072Histone-fold
SuperFamilySSF471131.55E-3764160IPR009072Histone-fold
PfamPF008081.6E-2567131IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.6E-1695113No hitNo description
PROSITE patternPS00685098114IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006154.6E-16114132No hitNo description
PRINTSPR006154.6E-16133151No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MSVQCCVCFI SAPRLVLPVN PNSNIPNFIT NINTNNANAN ANLNVNANTS SGNQRAHPCI  60
IREQDQYMPI ANVIRIMRRI LPSHAKISDD AKETIQECVS EYISFITGEA NERCQREQRK  120
TVTAEDVLWA MGKLGFDDYV EPLTVYLNRY REAENERNNL RVDQLPYVGF KRSMDYGPVG  180
VPPGPPPYGP GFPMAHHLGM FDASAMGGGS SSSAGAQNSG LPSFDPYAQF K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A3e-3962152393NF-YB
4awl_B4e-3962152494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A4e-3962152494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012465928.14e-80PREDICTED: nuclear transcription factor Y subunit B-9
SwissprotQ9SFD88e-68NFYB9_ARATH; Nuclear transcription factor Y subunit B-9
TrEMBLA0A0D2SEP94e-80A0A0D2SEP9_G
TrEMBLA0A0E3N6S23e-80A0A0E3N6S2_G
STRINGVIT_00s0956g00020.t014e-75(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27283279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.19e-56NF-YB family protein